| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
| Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
| Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species) |
| Species Bacillus sp., strain ps3 [TaxId:1409] [88931] (1 PDB entry) |
| Domain d1skye1: 1sky E:357-470 [18314] Other proteins in same PDB: d1skyb1, d1skyb2, d1skyb3, d1skye2, d1skye3 complexed with so4 |
PDB Entry: 1sky (more details), 3.2 Å
SCOPe Domain Sequences for d1skye1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1skye1 a.69.1.1 (E:357-470) F1 ATP synthase beta subunit, domain 3 {Bacillus sp., strain ps3 [TaxId: 1409]}
eivgeehyqvarkvqqtlerykelqdiiailgmdelsdedklvvhrarriqfflsqnfhv
aeqftgqpgsyvpvketvrgfkeilegkydhlpedrfrlvgrieevvekakamg
Timeline for d1skye1: