| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily) contains mixed beta-sheet |
Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) ![]() |
| Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins) Family 2 zinc amidase; |
| Protein automated matches [190549] (3 species) not a true protein |
| Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (15 PDB entries) |
| Domain d3olkd_: 3olk D: [183139] automated match to d1ycka1 complexed with amu, gol, tla |
PDB Entry: 3olk (more details), 2.6 Å
SCOPe Domain Sequences for d3olkd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3olkd_ d.118.1.1 (D:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra
Timeline for d3olkd_: