SCOPe 2.07: Domain d3olfa1: 3olf A:248-476

Lineage for d3olfa1 (3olf A:248-476)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)

6. Protein automated matches [190059] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (155 PDB entries)

8. Domain d3olfa1: 3olf A:248-476 [183134]
   Other proteins in same PDB: d3olfa2, d3olfc2
   automated match to d1osha_
   protein/DNA complex; complexed with olf

Details for d3olfa1

PDB Entry: 3olf, 1.9 Å

PDB Description: Crystal structure of human FXR in complex with 4-({(2S)-2-[2-(4-chlorophenyl)-5,6-difluoro-1H-benzimidazol-1-yl]-2-cyclohexylacetyl}amino)-3-methylbenzoic acid

PDB Compounds: (A:) Bile acid receptor

SCOPe Domain Sequences for d3olfa1:

Sequence; same for both SEQRES and ATOM records:

>d3olfa1 a.123.1.1 (A:248-476) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltpdqqtllhfimdsynkqrmpqeitnkilkeafsaeenfliltematnhvqvlveftk
klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdllearirnsgisdeyit
pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
penpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq

Timeline for d3olfa1:

• d3olfa1 first appeared in SCOPe 2.01, called d3olfa_
  
• d3olfa1 appears in SCOPe 2.06