Lineage for d1skyb1 (1sky B:372-502)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540119Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 540120Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 540121Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 540122Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species)
  7. 540123Species Bacillus sp., strain ps3 [TaxId:1409] [88926] (1 PDB entry)
  8. 540124Domain d1skyb1: 1sky B:372-502 [18313]
    Other proteins in same PDB: d1skyb2, d1skyb3, d1skye1, d1skye2, d1skye3
    complexed with so4

Details for d1skyb1

PDB Entry: 1sky (more details), 3.2 Å

PDB Description: crystal structure of the nucleotide free alpha3beta3 sub-complex of f1-atpase from the thermophilic bacillus ps3

SCOP Domain Sequences for d1skyb1:

Sequence, based on SEQRES records: (download)

>d1skyb1 a.69.1.1 (B:372-502) F1 ATP synthase alpha subunit, domain 3 {Bacillus sp., strain ps3}
ikamkkvagtlrldlaayreleafaqfgsdldkatqanvargartvevlkqdlhqpipve
kqvliiyaltrgflddipvedvrrfekefylwldqngqhllehirttkdlpneddlnqai
eafkktfvvsq

Sequence, based on observed residues (ATOM records): (download)

>d1skyb1 a.69.1.1 (B:372-502) F1 ATP synthase alpha subunit, domain 3 {Bacillus sp., strain ps3}
ikamkkvagtlrldlaayrelefaqfsddkatqanvargartvevlkqdlhqpipvekqv
liiyaltrgflddipvedvrrfekefylwldqngqhllehirttkdlpneddlnqaieaf
kktfvvsq

SCOP Domain Coordinates for d1skyb1:

Click to download the PDB-style file with coordinates for d1skyb1.
(The format of our PDB-style files is described here.)

Timeline for d1skyb1: