SCOP 1.67: Domain d1skyb1: 1sky B:372-502

Lineage for d1skyb1 (1sky B:372-502)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species)

7. Species Bacillus sp., strain ps3 [TaxId:1409] [88926] (1 PDB entry)

8. Domain d1skyb1: 1sky B:372-502 [18313]
   Other proteins in same PDB: d1skyb2, d1skyb3, d1skye1, d1skye2, d1skye3
   complexed with so4

Details for d1skyb1

PDB Entry: 1sky, 3.2 Å

PDB Description: crystal structure of the nucleotide free alpha3beta3 sub-complex of f1-atpase from the thermophilic bacillus ps3

SCOP Domain Sequences for d1skyb1:

Sequence, based on SEQRES records:

>d1skyb1 a.69.1.1 (B:372-502) F1 ATP synthase alpha subunit, domain 3 {Bacillus sp., strain ps3}
ikamkkvagtlrldlaayreleafaqfgsdldkatqanvargartvevlkqdlhqpipve
kqvliiyaltrgflddipvedvrrfekefylwldqngqhllehirttkdlpneddlnqai
eafkktfvvsq

Sequence, based on observed residues (ATOM records):

>d1skyb1 a.69.1.1 (B:372-502) F1 ATP synthase alpha subunit, domain 3 {Bacillus sp., strain ps3}
ikamkkvagtlrldlaayrelefaqfsddkatqanvargartvevlkqdlhqpipvekqv
liiyaltrgflddipvedvrrfekefylwldqngqhllehirttkdlpneddlnqaieaf
kktfvvsq

Timeline for d1skyb1:

• d1skyb1 first appeared (with stable ids) in SCOP 1.55
  
• d1skyb1 appears in SCOP 1.65
  
• d1skyb1 appears in SCOP 1.69
  
• d1skyb1 appears in the current release, SCOPe 2.08