SCOP 1.63: Domain d1mabb1: 1mab B:358-477

Lineage for d1mabb1 (1mab B:358-477)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)

6. Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47921] (1 PDB entry)

8. Domain d1mabb1: 1mab B:358-477 [18312]
   Other proteins in same PDB: d1maba2, d1maba3, d1mabb2, d1mabb3, d1mabg_
   complexed with adp, atp, mg, po4

Details for d1mabb1

PDB Entry: 1mab, 2.8 Å

PDB Description: rat liver f1-atpase

SCOP Domain Sequences for d1mabb1:

Sequence; same for both SEQRES and ATOM records:

>d1mabb1 a.69.1.1 (B:358-477) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Rat (Rattus norvegicus)}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghmgklvplketikgfqqilagdydhlpeqafymvgpieeavakadklaeeh

Timeline for d1mabb1:

• d1mabb1 first appeared (with stable ids) in SCOP 1.55
  
• d1mabb1 appears in SCOP 1.61
  
• d1mabb1 appears in SCOP 1.65
  
• d1mabb1 appears in the current release, SCOPe 2.08