Class a: All alpha proteins [46456] (202 folds) |
Fold a.69: Left-handed superhelix [47916] (3 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) |
Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [88925] (1 PDB entry) |
Domain d1maba1: 1mab A:380-510 [18311] Other proteins in same PDB: d1maba2, d1maba3, d1mabb1, d1mabb2, d1mabb3, d1mabg_ complexed with adp, atp, mg, po4 |
PDB Entry: 1mab (more details), 2.8 Å
SCOP Domain Sequences for d1maba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1maba1 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit, domain 3 {Rat (Rattus norvegicus)} tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie eqvaviyagvrgyldklepskitkfesaflshvvsqhqsllgnirtdgkiseqsdaklke ivtnflagfep
Timeline for d1maba1:
View in 3D Domains from other chains: (mouse over for more information) d1mabb1, d1mabb2, d1mabb3, d1mabg_ |