SCOPe 2.08: Domain d1maba1: 1mab A:380-510

Lineage for d1maba1 (1mab A:380-510)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase alpha subunit, domain 3 [88886] (5 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88925] (1 PDB entry)

8. Domain d1maba1: 1mab A:380-510 [18311]
   Other proteins in same PDB: d1maba2, d1maba3, d1mabb1, d1mabb2, d1mabb3, d1mabg_
   complexed with adp, atp, mg, po4

Details for d1maba1

PDB Entry: 1mab, 2.8 Å

PDB Description: rat liver f1-atpase

PDB Compounds: (A:) protein (f1-ATPase alpha chain)

SCOPe Domain Sequences for d1maba1:

Sequence; same for both SEQRES and ATOM records:

>d1maba1 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit, domain 3 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfesaflshvvsqhqsllgnirtdgkiseqsdaklke
ivtnflagfep

Timeline for d1maba1:

• d1maba1 first appeared (with stable ids) in SCOP 1.55
  
• d1maba1 appears in SCOPe 2.07