Lineage for d3okrc_ (3okr C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1381405Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1381406Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1382226Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 1382227Protein automated matches [190951] (20 species)
    not a true protein
  7. 1382282Species Mycobacterium tuberculosis [TaxId:83332] [189483] (7 PDB entries)
  8. 1382292Domain d3okrc_: 3okr C: [183105]
    automated match to d1vpaa_

Details for d3okrc_

PDB Entry: 3okr (more details), 2.4 Å

PDB Description: Structure of Mtb apo 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase (IspD)
PDB Compounds: (C:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d3okrc_:

Sequence, based on SEQRES records: (download)

>d3okrc_ c.68.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
evvaivpaagsgerlavgvpkafyqldgqtlieravdglldsgvvdtvvvavpadrtdea
rqilghramivaggsnrtdtvnlaltvlsgtaepefvlvhdaaraltppalvarvvealr
dgyaavvpvlplsdtikavdangvvlgtperaglravqtpqgfttdlllrsyqrgsldlp
aaeytddaslvehiggqvqvvdgdplafkittkldlllaqaivrg

Sequence, based on observed residues (ATOM records): (download)

>d3okrc_ c.68.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
evvaivpapkafyqldgqtlieravdglldsgvvdtvvvavpadrtdearqilghramiv
agvnlaltvlsepefvlvhdaaraltppalvarvvealrdgyaavvpvlplsdtikavda
ngvvlgtperaglravqtpqgfttdlllrsyqytddaslvehiggqvqvvdgdplafkit
tkldlllaqaivrg

SCOPe Domain Coordinates for d3okrc_:

Click to download the PDB-style file with coordinates for d3okrc_.
(The format of our PDB-style files is described here.)

Timeline for d3okrc_: