Lineage for d3okjx_ (3okj X:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2226421Protein Proteasome beta subunit (catalytic) [56252] (6 species)
  7. 2226430Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (174 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2226917Domain d3okjx_: 3okj X: [183100]
    Other proteins in same PDB: d3okja_, d3okjb_, d3okjc_, d3okje_, d3okjf_, d3okjg_, d3okjo_, d3okjp_, d3okjq_, d3okjs_, d3okjt_, d3okju_
    automated match to d1g0uj_
    complexed with ep9

Details for d3okjx_

PDB Entry: 3okj (more details), 2.7 Å

PDB Description: alpha-keto-aldehyde binding mechanism reveals a novel lead structure motif for proteasome inhibition
PDB Compounds: (X:) Proteasome component C11

SCOPe Domain Sequences for d3okjx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3okjx_ d.153.1.4 (X:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
vkivdkdgirqvddfqaq

SCOPe Domain Coordinates for d3okjx_:

Click to download the PDB-style file with coordinates for d3okjx_.
(The format of our PDB-style files is described here.)

Timeline for d3okjx_: