Lineage for d1cowe1 (1cow E:358-474)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 282945Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 282946Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 282947Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 282987Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)
  7. 282990Species Cow (Bos taurus) [TaxId:9913] [88929] (10 PDB entries)
  8. 283019Domain d1cowe1: 1cow E:358-474 [18309]
    Other proteins in same PDB: d1cowa1, d1cowa2, d1cowa3, d1cowb1, d1cowb2, d1cowb3, d1cowc1, d1cowc2, d1cowc3, d1cowd2, d1cowd3, d1cowe2, d1cowe3, d1cowf2, d1cowf3, d1cowg_

Details for d1cowe1

PDB Entry: 1cow (more details), 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with aurovertin b

SCOP Domain Sequences for d1cowe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cowe1 a.69.1.1 (E:358-474) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus)}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOP Domain Coordinates for d1cowe1:

Click to download the PDB-style file with coordinates for d1cowe1.
(The format of our PDB-style files is described here.)

Timeline for d1cowe1: