SCOP 1.57: Domain d1cowe1: 1cow E:358-474

Lineage for d1cowe1 (1cow E:358-474)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.69: Left-handed superhelix [47916] (2 superfamilies)

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)

6. Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47920] (9 PDB entries)

8. Domain d1cowe1: 1cow E:358-474 [18309]
   Other proteins in same PDB: d1cowa2, d1cowa3, d1cowb2, d1cowb3, d1cowc2, d1cowc3, d1cowd2, d1cowd3, d1cowe2, d1cowe3, d1cowf2, d1cowf3, d1cowg_

Details for d1cowe1

PDB Entry: 1cow, 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with aurovertin b

SCOP Domain Sequences for d1cowe1:

Sequence; same for both SEQRES and ATOM records:

>d1cowe1 a.69.1.1 (E:358-474) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

Timeline for d1cowe1:

• d1cowe1 first appeared (with stable ids) in SCOP 1.55
  
• d1cowe1 appears in SCOP 1.59
  
• d1cowe1 appears in the current release, SCOPe 2.08