| Class a: All alpha proteins [46456] (138 folds) |
| Fold a.69: Left-handed superhelix [47916] (2 superfamilies) |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) ![]() |
| Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein) |
| Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (3 species) |
| Species Cow (Bos taurus) [TaxId:9913] [47920] (7 PDB entries) |
| Domain d1cowc1: 1cow C:380-510 [18307] Other proteins in same PDB: d1cowa2, d1cowa3, d1cowb2, d1cowb3, d1cowc2, d1cowc3, d1cowd2, d1cowd3, d1cowe2, d1cowe3, d1cowf2, d1cowf3, d1cowg_ |
PDB Entry: 1cow (more details), 3.1 Å
SCOP Domain Sequences for d1cowc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cowc1 a.69.1.1 (C:380-510) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea
Timeline for d1cowc1: