Lineage for d3ohuf_ (3ohu F:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1024736Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1024737Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1024851Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 1024852Protein automated matches [190710] (2 species)
    not a true protein
  7. 1024853Species Human (Homo sapiens) [TaxId:9606] [187857] (10 PDB entries)
  8. 1024868Domain d3ohuf_: 3ohu F: [183040]
    automated match to d1r28a_

Details for d3ohuf_

PDB Entry: 3ohu (more details), 2.1 Å

PDB Description: Crystal structure of the human Bach2 POZ domain, form I
PDB Compounds: (F:) Transcription regulator protein BACH2

SCOPe Domain Sequences for d3ohuf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ohuf_ d.42.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yvyestvhctnillglndqrkkdilcdvtliverkefrahravlaacseyfwqalvgqtk
ndlvvslpeevtargfgpllqfaytaklllsrenirevircaeflrmhnledscfsfl

SCOPe Domain Coordinates for d3ohuf_:

Click to download the PDB-style file with coordinates for d3ohuf_.
(The format of our PDB-style files is described here.)

Timeline for d3ohuf_: