Lineage for d1efrf1 (1efr F:358-474)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49089Fold a.69: Left-handed superhelix [47916] (2 superfamilies)
  4. 49090Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 49091Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)
  6. 49092Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)
  7. 49096Species Cow (Bos taurus) [TaxId:9913] [47920] (9 PDB entries)
  8. 49138Domain d1efrf1: 1efr F:358-474 [18304]
    Other proteins in same PDB: d1efra2, d1efra3, d1efrb2, d1efrb3, d1efrc2, d1efrc3, d1efrd2, d1efrd3, d1efre2, d1efre3, d1efrf2, d1efrf3, d1efrg_

Details for d1efrf1

PDB Entry: 1efr (more details), 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin

SCOP Domain Sequences for d1efrf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efrf1 a.69.1.1 (F:358-474) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOP Domain Coordinates for d1efrf1:

Click to download the PDB-style file with coordinates for d1efrf1.
(The format of our PDB-style files is described here.)

Timeline for d1efrf1: