SCOPe 2.07: Domain d3ohpc_: 3ohp C:

Lineage for d3ohpc_ (3ohp C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein automated matches [190074] (15 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [189453] (1 PDB entry)

8. Domain d3ohpc_: 3ohp C: [183033]
   automated match to d1g9sa_

Details for d3ohpc_

PDB Entry: 3ohp, 2.04 Å

PDB Description: crystal structure of hgprt from vibrio cholerae

PDB Compounds: (C:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d3ohpc_:

Sequence, based on SEQRES records:

>d3ohpc_ c.61.1.1 (C:) automated matches {Vibrio cholerae [TaxId: 666]}
htvevmiseqevaqrirelgqqitehyqgssdlvlvgllrgsfvfmadlarqihlthqvd
fmtassygnsmqssrdvrilkdldddikgkdvllvediidtgntlnkvkeilalrepksi
rictlldkptrrevdvevnwvgfeipdefvvgvgidyaqkyrhlpyigkvvpla

Sequence, based on observed residues (ATOM records):

>d3ohpc_ c.61.1.1 (C:) automated matches {Vibrio cholerae [TaxId: 666]}
htvevmiseqevaqrirelgqqitehyqgssdlvlvgllrgsfvfmadlarqihlthqvd
fmtasssrdvrilkdldddikgkdvllvediidtgntlnkvkeilalrepksirictlld
kptrrevdvevnwvgfeipdefvvgvgidyaqkyrhlpyigkvvpla

Timeline for d3ohpc_:

• d3ohpc_ first appeared in SCOPe 2.01
  
• d3ohpc_ appears in SCOPe 2.06
  
• d3ohpc_ appears in the current release, SCOPe 2.08