Lineage for d3ohpa_ (3ohp A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128257Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 protein domains)
  6. 2128615Protein automated matches [190074] (13 species)
    not a true protein
  7. 2128645Species Vibrio cholerae [TaxId:666] [189453] (1 PDB entry)
  8. 2128646Domain d3ohpa_: 3ohp A: [183031]
    automated match to d1g9sa_

Details for d3ohpa_

PDB Entry: 3ohp (more details), 2.04 Å

PDB Description: Crystal structure of HGPRT from Vibrio cholerae
PDB Compounds: (A:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d3ohpa_:

Sequence, based on SEQRES records: (download)

>d3ohpa_ c.61.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
khtvevmiseqevaqrirelgqqitehyqgssdlvlvgllrgsfvfmadlarqihlthqv
dfmtassygnsmqssrdvrilkdldddikgkdvllvediidtgntlnkvkeilalrepks
irictlldkptrrevdvevnwvgfeipdefvvgvgidyaqkyrhlpyigkvvpla

Sequence, based on observed residues (ATOM records): (download)

>d3ohpa_ c.61.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
khtvevmiseqevaqrirelgqqitehyqgssdlvlvgllrgsfvfmadlarqihlthqv
dfmtassrdvrilkdldddikgkdvllvediidtgntlnkvkeilalrepksirictlld
kptrrevdvevnwvgfeipdefvvgvgidyaqkyrhlpyigkvvpla

SCOPe Domain Coordinates for d3ohpa_:

Click to download the PDB-style file with coordinates for d3ohpa_.
(The format of our PDB-style files is described here.)

Timeline for d3ohpa_: