Lineage for d1efre1 (1efr E:358-474)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1739159Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 1739160Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families) (S)
  5. 1739161Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 1739216Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)
  7. 1739219Species Cow (Bos taurus) [TaxId:9913] [88929] (18 PDB entries)
    Uniprot P00829
  8. 1739272Domain d1efre1: 1efr E:358-474 [18303]
    Other proteins in same PDB: d1efra1, d1efra2, d1efra3, d1efrb1, d1efrb2, d1efrb3, d1efrc1, d1efrc2, d1efrc3, d1efrd2, d1efrd3, d1efre2, d1efre3, d1efrf2, d1efrf3, d1efrg_
    complexed with adp, anp, mg

Details for d1efre1

PDB Entry: 1efr (more details), 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin
PDB Compounds: (E:) bovine mitochondrial f1-ATPase subunit beta

SCOPe Domain Sequences for d1efre1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efre1 a.69.1.1 (E:358-474) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOPe Domain Coordinates for d1efre1:

Click to download the PDB-style file with coordinates for d1efre1.
(The format of our PDB-style files is described here.)

Timeline for d1efre1: