Lineage for d1efre1 (1efr E:358-474)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215201Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 215202Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 215203Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)
  6. 215204Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)
  7. 215208Species Cow (Bos taurus) [TaxId:9913] [47920] (9 PDB entries)
  8. 215249Domain d1efre1: 1efr E:358-474 [18303]
    Other proteins in same PDB: d1efra2, d1efra3, d1efrb2, d1efrb3, d1efrc2, d1efrc3, d1efrd2, d1efrd3, d1efre2, d1efre3, d1efrf2, d1efrf3, d1efrg_

Details for d1efre1

PDB Entry: 1efr (more details), 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin

SCOP Domain Sequences for d1efre1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efre1 a.69.1.1 (E:358-474) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOP Domain Coordinates for d1efre1:

Click to download the PDB-style file with coordinates for d1efre1.
(The format of our PDB-style files is described here.)

Timeline for d1efre1: