Lineage for d3ohla_ (3ohl A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964558Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. 2964559Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries)
  8. 2964591Domain d3ohla_: 3ohl A: [183029]
    automated match to d1b3db_
    complexed with ca, ohl, so4, zn

Details for d3ohla_

PDB Entry: 3ohl (more details), 2.36 Å

PDB Description: catalytic domain of stromelysin-1 in complex with N-Hydroxy-2-(4-methoxy-N-(pyridine-3-ylmethyl)phenylsulfonamido)acetamide
PDB Compounds: (A:) stromelysin-1

SCOPe Domain Sequences for d3ohla_:

Sequence, based on SEQRES records: (download)

>d3ohla_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpp

Sequence, based on observed residues (ATOM records): (download)

>d3ohla_ d.92.1.11 (A:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsanalmyplyhrfrlsqddingiqslygpp

SCOPe Domain Coordinates for d3ohla_:

Click to download the PDB-style file with coordinates for d3ohla_.
(The format of our PDB-style files is described here.)

Timeline for d3ohla_: