Lineage for d3ogxa_ (3ogx A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972806Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 2972807Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 2972808Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 2972872Protein automated matches [190549] (4 species)
    not a true protein
  7. 2972875Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (40 PDB entries)
  8. 2972992Domain d3ogxa_: 3ogx A: [183023]
    automated match to d1ycka1
    complexed with gol, tla

Details for d3ogxa_

PDB Entry: 3ogx (more details), 2.8 Å

PDB Description: crystal structure of the complex of peptidoglycan recognition protein (pgrp-s) with heparin-dissacharide at 2.8 a resolution
PDB Compounds: (A:) Peptidoglycan recognition protein 1

SCOPe Domain Sequences for d3ogxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ogxa_ d.118.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra

SCOPe Domain Coordinates for d3ogxa_:

Click to download the PDB-style file with coordinates for d3ogxa_.
(The format of our PDB-style files is described here.)

Timeline for d3ogxa_: