Lineage for d3ogpb_ (3ogp B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2391027Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2392314Protein automated matches [190433] (11 species)
    not a true protein
  7. 2392317Species Feline immunodeficiency virus [TaxId:11673] [189983] (2 PDB entries)
  8. 2392319Domain d3ogpb_: 3ogp B: [183020]
    automated match to d6fiva_
    complexed with 017, dms

Details for d3ogpb_

PDB Entry: 3ogp (more details), 1.7 Å

PDB Description: Crystal Structure of 6s-98S FIV Protease with Darunavir bound
PDB Compounds: (B:) FIV Protease

SCOPe Domain Sequences for d3ogpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ogpb_ b.50.1.1 (B:) automated matches {Feline immunodeficiency virus [TaxId: 11673]}
gttttlekrpeilifvngypikflldtgaditvlnrrdfqvknsiengrqmmigigggkr
gtnyinvhleirdenyktqcifgnvcvlednslsvnllgrdnmikfnirlvm

SCOPe Domain Coordinates for d3ogpb_:

Click to download the PDB-style file with coordinates for d3ogpb_.
(The format of our PDB-style files is described here.)

Timeline for d3ogpb_: