SCOP 1.55: Domain d1efrd1: 1efr D:358-475

Lineage for d1efrd1 (1efr D:358-475)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.69: Left-handed superhelix [47916] (2 superfamilies)

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)

6. Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47920] (7 PDB entries)

8. Domain d1efrd1: 1efr D:358-475 [18302]
   Other proteins in same PDB: d1efra2, d1efra3, d1efrb2, d1efrb3, d1efrc2, d1efrc3, d1efrd2, d1efrd3, d1efre2, d1efre3, d1efrf2, d1efrf3, d1efrg_

Details for d1efrd1

PDB Entry: 1efr, 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin

SCOP Domain Sequences for d1efrd1:

Sequence; same for both SEQRES and ATOM records:

>d1efrd1 a.69.1.1 (D:358-475) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadklae

Timeline for d1efrd1:

• d1efrd1 appears in SCOP 1.57
  
• d1efrd1 appears in the current release, SCOPe 2.08