SCOPe 2.08: Domain d3ogpa_: 3ogp A:

Lineage for d3ogpa_ (3ogp A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (12 species)
   not a true protein

7. Species Feline immunodeficiency virus [TaxId:11673] [189983] (2 PDB entries)

8. Domain d3ogpa_: 3ogp A: [183019]
   automated match to d6fiva_
   complexed with 017, dms

Details for d3ogpa_

PDB Entry: 3ogp, 1.7 Å

PDB Description: Crystal Structure of 6s-98S FIV Protease with Darunavir bound

PDB Compounds: (A:) FIV Protease

SCOPe Domain Sequences for d3ogpa_:

Sequence; same for both SEQRES and ATOM records:

>d3ogpa_ b.50.1.1 (A:) automated matches {Feline immunodeficiency virus [TaxId: 11673]}
gttttlekrpeilifvngypikflldtgaditvlnrrdfqvknsiengrqmmigigggkr
gtnyinvhleirdenyktqcifgnvcvlednslsvnllgrdnmikfnirlvm

Timeline for d3ogpa_:

• d3ogpa_ first appeared in SCOPe 2.01
  
• d3ogpa_ appears in SCOPe 2.07