Class b: All beta proteins [48724] (180 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein automated matches [190433] (12 species) not a true protein |
Species Feline immunodeficiency virus [TaxId:11673] [189983] (2 PDB entries) |
Domain d3ogpa_: 3ogp A: [183019] automated match to d6fiva_ complexed with 017, dms |
PDB Entry: 3ogp (more details), 1.7 Å
SCOPe Domain Sequences for d3ogpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ogpa_ b.50.1.1 (A:) automated matches {Feline immunodeficiency virus [TaxId: 11673]} gttttlekrpeilifvngypikflldtgaditvlnrrdfqvknsiengrqmmigigggkr gtnyinvhleirdenyktqcifgnvcvlednslsvnllgrdnmikfnirlvm
Timeline for d3ogpa_: