Lineage for d3ogoh_ (3ogo H:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931683Protein automated matches [190119] (11 species)
    not a true protein
  7. 931684Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (16 PDB entries)
  8. 931706Domain d3ogoh_: 3ogo H: [183018]
    Other proteins in same PDB: d3ogoa_, d3ogob_, d3ogoc_, d3ogod_
    automated match to d1vhpa_
    complexed with ipa

Details for d3ogoh_

PDB Entry: 3ogo (more details), 2.8 Å

PDB Description: structure of the gfp:gfp-nanobody complex at 2.8 a resolution in spacegroup p21212
PDB Compounds: (H:) GFP-nanobody

SCOPe Domain Sequences for d3ogoh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ogoh_ b.1.1.1 (H:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesggalvqpggslrlscaasgfpvnrysmrwyrqapgkerewvagmssagdrssy
edsvkgrftisrddarntvylqmnslkpedtavyycnvnvgfeywgqgtqvtvssk

SCOPe Domain Coordinates for d3ogoh_:

Click to download the PDB-style file with coordinates for d3ogoh_.
(The format of our PDB-style files is described here.)

Timeline for d3ogoh_: