Lineage for d3ogob_ (3ogo B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2939778Protein Green fluorescent protein, GFP [54513] (6 species)
  7. 2939786Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
    Uniprot P42212
  8. 2940106Domain d3ogob_: 3ogo B: [183012]
    Other proteins in same PDB: d3ogoe_, d3ogof_, d3ogog_, d3ogoh1, d3ogoh2
    automated match to d1qyoa_
    complexed with ipa

Details for d3ogob_

PDB Entry: 3ogo (more details), 2.8 Å

PDB Description: structure of the gfp:gfp-nanobody complex at 2.8 a resolution in spacegroup p21212
PDB Compounds: (B:) Green fluorescent protein

SCOPe Domain Sequences for d3ogob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ogob_ d.22.1.1 (B:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
tlgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy
qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

SCOPe Domain Coordinates for d3ogob_:

Click to download the PDB-style file with coordinates for d3ogob_.
(The format of our PDB-style files is described here.)

Timeline for d3ogob_: