Lineage for d3ogba_ (3ogb A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1474672Protein Myoglobin [46469] (9 species)
  7. 1474793Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (239 PDB entries)
    Uniprot P02185
  8. 1474875Domain d3ogba_: 3ogb A: [183010]
    automated match to d1mgna_
    complexed with hem, so4; mutant

Details for d3ogba_

PDB Entry: 3ogb (more details), 1.6 Å

PDB Description: Sperm whale myoglobin mutant H64W deoxy-form
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d3ogba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ogba_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkwgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d3ogba_:

Click to download the PDB-style file with coordinates for d3ogba_.
(The format of our PDB-style files is described here.)

Timeline for d3ogba_: