Lineage for d3ofub_ (3ofu B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005772Species Novosphingobium aromaticivorans [TaxId:279238] [189372] (11 PDB entries)
  8. 2005790Domain d3ofub_: 3ofu B: [183001]
    automated match to d1k2oa_
    complexed with hem, id3

Details for d3ofub_

PDB Entry: 3ofu (more details), 2.8 Å

PDB Description: Crystal Structure of Cytochrome P450 CYP101C1
PDB Compounds: (B:) cytochrome p450

SCOPe Domain Sequences for d3ofub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ofub_ a.104.1.0 (B:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
mipahvpadrvvdfdifnppgveqdyfaawktlldgpglvwstangghwiaargdvvrel
wgdaerlssqclavtpglgkvmqfiplqqdgaehkafrtpvmkglasrfvvalepkvqav
arklmeslrprgscdfvsdfaeilplnifltlidvpledrprlrqlgvqltrpdgsmtve
qlkqaaddylwpfiekrmaqpgddlfsrilsepvggrpwtvdearrmcrnllfggldtva
amigmvalhlarhpedqrllrerpdlipaaadelmrryptvavsrnavadvdadgvtirk
gdlvylpsvlhnldpasfeapeevrfdrglapirhttmgvgahrcvgaglarmevivflr
ewlggmpefalapdkavtmkggnvgactalplvwra

SCOPe Domain Coordinates for d3ofub_:

Click to download the PDB-style file with coordinates for d3ofub_.
(The format of our PDB-style files is described here.)

Timeline for d3ofub_: