Lineage for d1efrb1 (1efr B:380-510)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 282945Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 282946Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 282947Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 282948Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species)
  7. 282951Species Cow (Bos taurus) [TaxId:9913] [88893] (10 PDB entries)
  8. 282971Domain d1efrb1: 1efr B:380-510 [18300]
    Other proteins in same PDB: d1efra2, d1efra3, d1efrb2, d1efrb3, d1efrc2, d1efrc3, d1efrd1, d1efrd2, d1efrd3, d1efre1, d1efre2, d1efre3, d1efrf1, d1efrf2, d1efrf3, d1efrg_

Details for d1efrb1

PDB Entry: 1efr (more details), 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin

SCOP Domain Sequences for d1efrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efrb1 a.69.1.1 (B:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus)}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

SCOP Domain Coordinates for d1efrb1:

Click to download the PDB-style file with coordinates for d1efrb1.
(The format of our PDB-style files is described here.)

Timeline for d1efrb1: