| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
| Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
| Protein automated matches [190142] (21 species) not a true protein |
| Species Vibrio cholerae [TaxId:666] [188799] (2 PDB entries) |
| Domain d3of3j_: 3of3 J: [182985] automated match to d1vhja_ complexed with dih, po4 |
PDB Entry: 3of3 (more details), 1.83 Å
SCOPe Domain Sequences for d3of3j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3of3j_ c.56.2.1 (J:) automated matches {Vibrio cholerae [TaxId: 666]}
atphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrkisvm
ghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirf
kdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgvem
eaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdqagy
Timeline for d3of3j_: