Lineage for d3of3c_ (3of3 C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 996821Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 996837Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 996838Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 997377Protein automated matches [190142] (12 species)
    not a true protein
  7. 997449Species Vibrio cholerae [TaxId:666] [188799] (2 PDB entries)
  8. 997452Domain d3of3c_: 3of3 C: [182978]
    automated match to d1vhja_
    complexed with dih, po4

Details for d3of3c_

PDB Entry: 3of3 (more details), 1.83 Å

PDB Description: crystal structure of pnp with an inhibitor dadme_immh from vibrio cholerae
PDB Compounds: (C:) Purine nucleoside phosphorylase deoD-type 1

SCOPe Domain Sequences for d3of3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3of3c_ c.56.2.1 (C:) automated matches {Vibrio cholerae [TaxId: 666]}
atphinaqmgdfadvvlmpgdplrakyiaenfldnavqvcdvrnmfgytgtykgrkisvm
ghgmgipscsiyvtelikdygvkkiirvgscgavnegikvrdvvigmgactdskvnrirf
kdhdfaaiadykmvkaaeeaakargidvkvgnlfsaelfytpdpsmfdvmdkygivgvem
eaagiygvaaeygakalaictvsdhiktgeqttseerqntfnemieialdsvligdqagy

SCOPe Domain Coordinates for d3of3c_:

Click to download the PDB-style file with coordinates for d3of3c_.
(The format of our PDB-style files is described here.)

Timeline for d3of3c_: