SCOPe 2.02: Domain d3oexd_: 3oex D:

Lineage for d3oexd_ (3oex D:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (15 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [189452] (2 PDB entries)

8. Domain d3oexd_: 3oex D: [182973]
   automated match to d1gqna_
   complexed with cl

Details for d3oexd_

PDB Entry: 3oex, 1.9 Å

PDB Description: crystal structure of type i 3-dehydroquinate dehydratase (arod) from salmonella typhimurium with close loop conformation.

PDB Compounds: (D:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d3oexd_:

Sequence; same for both SEQRES and ATOM records:

>d3oexd_ c.1.10.1 (D:) automated matches {Salmonella typhimurium [TaxId: 90371]}
ktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaesv
leaagaireiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftgd
devkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkadv
ltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgqisvad
lrtvltilhqa

Timeline for d3oexd_:

• d3oexd_ first appeared in SCOPe 2.01
  
• d3oexd_ appears in SCOPe 2.03
  
• d3oexd_ appears in the current release, SCOPe 2.08