![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
![]() | Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families) ![]() |
![]() | Family d.82.2.1: Frataxin-like [55388] (3 proteins) iron homeostasis proteins automatically mapped to Pfam PF01491 |
![]() | Protein C-terminal domain of frataxin [55389] (2 species) protein responsible for Friedreich ataxia |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143571] (5 PDB entries) Uniprot Q07540 52-174! Uniprot Q07540 61-172 |
![]() | Domain d3oeqa_: 3oeq A: [182968] automated match to d2ga5a1 |
PDB Entry: 3oeq (more details), 2.96 Å
SCOPe Domain Sequences for d3oeqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oeqa_ d.82.2.1 (A:) C-terminal domain of frataxin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vesstdgqvvpqevlnlplekaheeaddyldhlldsleelseahpdcipdvelshgvmtl eipafgtyvinkqppnkqiwlasplsgpnrfdllngewvslrngtkltdilteevekais k
Timeline for d3oeqa_: