Lineage for d1e1qd1 (1e1q D:358-475)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 357519Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 357520Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 357521Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 357561Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)
  7. 357564Species Cow (Bos taurus) [TaxId:9913] [88929] (10 PDB entries)
  8. 357586Domain d1e1qd1: 1e1q D:358-475 [18296]
    Other proteins in same PDB: d1e1qa1, d1e1qa2, d1e1qa3, d1e1qb1, d1e1qb2, d1e1qb3, d1e1qc1, d1e1qc2, d1e1qc3, d1e1qd2, d1e1qd3, d1e1qe2, d1e1qe3, d1e1qf2, d1e1qf3, d1e1qg_

Details for d1e1qd1

PDB Entry: 1e1q (more details), 2.61 Å

PDB Description: bovine mitochondrial f1-atpase at 100k

SCOP Domain Sequences for d1e1qd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1qd1 a.69.1.1 (D:358-475) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus)}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadklae

SCOP Domain Coordinates for d1e1qd1:

Click to download the PDB-style file with coordinates for d1e1qd1.
(The format of our PDB-style files is described here.)

Timeline for d1e1qd1: