Lineage for d1e1qd1 (1e1q D:358-475)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717310Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 2717381Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species)
  7. 2717430Species Cow (Bos taurus) [TaxId:9913] [88929] (18 PDB entries)
    Uniprot P00829
  8. 2717479Domain d1e1qd1: 1e1q D:358-475 [18296]
    Other proteins in same PDB: d1e1qa1, d1e1qa2, d1e1qa3, d1e1qb1, d1e1qb2, d1e1qb3, d1e1qc1, d1e1qc2, d1e1qc3, d1e1qd2, d1e1qd3, d1e1qe2, d1e1qe3, d1e1qf2, d1e1qf3, d1e1qg_
    complexed with adp, anp, mg, po4

Details for d1e1qd1

PDB Entry: 1e1q (more details), 2.61 Å

PDB Description: bovine mitochondrial f1-atpase at 100k
PDB Compounds: (D:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1e1qd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1qd1 a.69.1.1 (D:358-475) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadklae

SCOPe Domain Coordinates for d1e1qd1:

Click to download the PDB-style file with coordinates for d1e1qd1.
(The format of our PDB-style files is described here.)

Timeline for d1e1qd1: