Lineage for d3oeep_ (3oee P:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 993924Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 994040Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 994070Family c.49.2.0: automated matches [191450] (1 protein)
    not a true family
  6. 994071Protein automated matches [190687] (1 species)
    not a true protein
  7. 994072Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187815] (2 PDB entries)
  8. 994077Domain d3oeep_: 3oee P: [182957]
    automated match to d1bmfg_
    complexed with anp, mg, po4; mutant

Details for d3oeep_

PDB Entry: 3oee (more details), 2.74 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: alpha-F405S
PDB Compounds: (P:) ATP synthase subunit gamma

SCOPe Domain Sequences for d3oeep_:

Sequence, based on SEQRES records: (download)

>d3oeep_ c.49.2.0 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
sknagdminrysilynrtrqavitnelvdiitgass

Sequence, based on observed residues (ATOM records): (download)

>d3oeep_ c.49.2.0 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetkke
livaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmhpiklsingigkdapt
fqesaliadkllsvmkagtypkisifyndpvssfepsekpifnaktidtdanvprdlfey
tlanqmltamaqgyaaeisarrnamdnasknagdminrysilynrtrqavitnelvdiit
gass

SCOPe Domain Coordinates for d3oeep_:

Click to download the PDB-style file with coordinates for d3oeep_.
(The format of our PDB-style files is described here.)

Timeline for d3oeep_: