Lineage for d3oe2a_ (3oe2 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185704Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2185705Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2186026Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2186027Protein automated matches [191162] (27 species)
    not a true protein
  7. 2186144Species Pseudomonas syringae [TaxId:223283] [189717] (2 PDB entries)
  8. 2186145Domain d3oe2a_: 3oe2 A: [182953]
    automated match to d1fd9a_
    complexed with srt, tar

Details for d3oe2a_

PDB Entry: 3oe2 (more details), 1.6 Å

PDB Description: 1.6 a crystal structure of peptidyl-prolyl cis-trans isomerase ppiase from pseudomonas syringae pv. tomato str. dc3000 (pspto dc3000)
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d3oe2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oe2a_ d.26.1.0 (A:) automated matches {Pseudomonas syringae [TaxId: 223283]}
gtdapteaalkaertfmagekakpgvkeladgilmteltpgtgpkpdangrvevryvgrl
pdgkifdqstqpqwfrldsvisgwtsalqnmptgakwrlvipsdqaygaegagdlidpft
plvfeieliavsq

SCOPe Domain Coordinates for d3oe2a_:

Click to download the PDB-style file with coordinates for d3oe2a_.
(The format of our PDB-style files is described here.)

Timeline for d3oe2a_: