![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
![]() | Protein automated matches [191162] (27 species) not a true protein |
![]() | Species Pseudomonas syringae [TaxId:223283] [189717] (2 PDB entries) |
![]() | Domain d3oe2a_: 3oe2 A: [182953] automated match to d1fd9a_ complexed with srt, tar |
PDB Entry: 3oe2 (more details), 1.6 Å
SCOPe Domain Sequences for d3oe2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oe2a_ d.26.1.0 (A:) automated matches {Pseudomonas syringae [TaxId: 223283]} gtdapteaalkaertfmagekakpgvkeladgilmteltpgtgpkpdangrvevryvgrl pdgkifdqstqpqwfrldsvisgwtsalqnmptgakwrlvipsdqaygaegagdlidpft plvfeieliavsq
Timeline for d3oe2a_: