Lineage for d3odyx_ (3ody X:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1221011Protein MAP kinase p38 [56129] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 1221012Species Human (Homo sapiens) [TaxId:9606] [56130] (124 PDB entries)
  8. 1221093Domain d3odyx_: 3ody X: [182951]
    automated match to d1a9ua_
    complexed with bog; mutant

Details for d3odyx_

PDB Entry: 3ody (more details), 2.2 Å

PDB Description: Crystal structure of p38alpha Y323Q active mutant
PDB Compounds: (X:) Mitogen-activated protein kinase 14

SCOPe Domain Sequences for d3odyx_:

Sequence, based on SEQRES records: (download)

>d3odyx_ d.144.1.7 (X:) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
ahayfaqyhdpddepvadpqdqsfesrdllidewksltydevisfvpppl

Sequence, based on observed residues (ATOM records): (download)

>d3odyx_ d.144.1.7 (X:) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]}
erptfyrqelnktiwevperyqnlspvgsvcaafdtktglrvavkklsrpfqsiihakrt
yrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddhvq
fliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglavatrwyrapeimlnwm
hynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpnyiqsltqmpkmnfan
vfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpqdqsfesrdl
lidewksltydevisfvpppl

SCOPe Domain Coordinates for d3odyx_:

Click to download the PDB-style file with coordinates for d3odyx_.
(The format of our PDB-style files is described here.)

Timeline for d3odyx_: