Lineage for d3od7a_ (3od7 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913797Protein Ferric-binding protein FbpA [53867] (7 species)
  7. 2913804Species Haemophilus influenzae [TaxId:727] [53868] (12 PDB entries)
  8. 2913811Domain d3od7a_: 3od7 A: [182946]
    automated match to d1d9va_
    complexed with fe, po4

    has additional insertions and/or extensions that are not grouped together

Details for d3od7a_

PDB Entry: 3od7 (more details), 1.8 Å

PDB Description: Haemophilus influenzae ferric binding protein A -Iron Loaded
PDB Compounds: (A:) Iron-utilization periplasmic protein

SCOPe Domain Sequences for d3od7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3od7a_ c.94.1.1 (A:) Ferric-binding protein FbpA {Haemophilus influenzae [TaxId: 727]}
ditvyngqhkeaatavakafeqetgikvtlnsgkseqlagqlkeegdktpadvfyteqta
tfadlseagllapiseqtiqqtaqkgvplapkkdwialsgrsrvvvydhtklsekdmeks
vldyatpkwkgkigyvstsgafleqvvalskmkgdkvalnwlkglkengklyaknsvalq
avengevpaalinnyywynlakekgvenlksrlyfvrhqdpgalvsysgaavlkasknqa
eaqkfvdflaskkgqealvaaraeyplradvvspfnlepyekleapvvsattaqdkehai
klieeagl

SCOPe Domain Coordinates for d3od7a_:

Click to download the PDB-style file with coordinates for d3od7a_.
(The format of our PDB-style files is described here.)

Timeline for d3od7a_: