SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3od5a_ (3od5 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2100990Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 2100991Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 2101162Family c.17.1.0: automated matches [191651] (1 protein)
    not a true family
  6. 2101163Protein automated matches [191201] (1 species)
    not a true protein
  7. 2101164Species Human (Homo sapiens) [TaxId:9606] [189525] (14 PDB entries)
  8. 2101165Domain d3od5a_: 3od5 A: [182943]
    automated match to d1cp3a_
    complexed with cac

Details for d3od5a_

PDB Entry: 3od5 (more details), 1.6 Å

PDB Description: Crystal structure of active caspase-6 bound with Ac-VEID-CHO
PDB Compounds: (A:) Caspase-6

SCOPe Domain Sequences for d3od5a_:

Sequence, based on SEQRES records: (download)

>d3od5a_ c.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fdpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlgfevkcfnd
lkaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltglfkgdkchs
lvgkpkifiiqacrgnqhdvpvipldvvdnqtekldtnitevdaasvytlpagadflmcy
svaegyyshretvngswyiqdlcemlgkygssleftelltlvnrkvsqrrvdfckdpsai
gkkqvpcfasmltkklhffpk

Sequence, based on observed residues (ATOM records): (download)

>d3od5a_ c.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fdpaekykmdhrrrgialifnherffwhltlperrgtcadrdnltrrfsdlgfevkcfnd
lkaeelllkihevstvshadadcfvcvflshgegnhiyaydakieiqtltglfkgdkchs
lvgkpkifiiqacrgnqhdvpviplvytlpagadflmcysvaegyyshretvngswyiqd
lcemlgkygssleftelltlvnrkvsqrrvdfckdpsaigkkqvpcfasmltkklhffpk

SCOPe Domain Coordinates for d3od5a_:

Click to download the PDB-style file with coordinates for d3od5a_.
(The format of our PDB-style files is described here.)

Timeline for d3od5a_: