SCOPe 2.08: Domain d3ocsa1: 3ocs A:395-656

Lineage for d3ocsa1 (3ocs A:395-656)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)

8. Domain d3ocsa1: 3ocs A:395-656 [182940]
   Other proteins in same PDB: d3ocsa2
   automated match to d1k2pa_
   complexed with 746, bme, so4

Details for d3ocsa1

PDB Entry: 3ocs, 1.8 Å

PDB Description: Crystal structure of bruton's tyrosine kinase in complex with inhibitor CGI1746

PDB Compounds: (A:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d3ocsa1:

Sequence; same for both SEQRES and ATOM records:

>d3ocsa1 d.144.1.7 (A:395-656) automated matches {Human (Homo sapiens) [TaxId: 9606]}
weidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmmnlsh
eklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyles
kqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlmyskf
ssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytimyscw
hekaderptfkillsnildvmd

Timeline for d3ocsa1:

• d3ocsa1 first appeared in SCOPe 2.01, called d3ocsa_
  
• d3ocsa1 appears in SCOPe 2.07