Lineage for d1e1qb1 (1e1q B:380-510)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49089Fold a.69: Left-handed superhelix [47916] (2 superfamilies)
  4. 49090Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 49091Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)
  6. 49092Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)
  7. 49096Species Cow (Bos taurus) [TaxId:9913] [47920] (9 PDB entries)
  8. 49122Domain d1e1qb1: 1e1q B:380-510 [18294]
    Other proteins in same PDB: d1e1qa2, d1e1qa3, d1e1qb2, d1e1qb3, d1e1qc2, d1e1qc3, d1e1qd2, d1e1qd3, d1e1qe2, d1e1qe3, d1e1qf2, d1e1qf3, d1e1qg_

Details for d1e1qb1

PDB Entry: 1e1q (more details), 2.61 Å

PDB Description: bovine mitochondrial f1-atpase at 100k

SCOP Domain Sequences for d1e1qb1:

Sequence, based on SEQRES records: (download)

>d1e1qb1 a.69.1.1 (B:380-510) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

Sequence, based on observed residues (ATOM records): (download)

>d1e1qb1 a.69.1.1 (B:380-510) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
tramkqvagtmklelaqyrevaldaatqqllsrgvrltellkqgqyspmaieeqvaviya
gvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklkeivtnflag
fea

SCOP Domain Coordinates for d1e1qb1:

Click to download the PDB-style file with coordinates for d1e1qb1.
(The format of our PDB-style files is described here.)

Timeline for d1e1qb1: