![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) ![]() contains extra C-terminal strand 5, order 21345 |
![]() | Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins) strand 5 is parallel to strand 4 |
![]() | Protein automated matches [191178] (1 species) not a true protein |
![]() | Species Salmonella enterica [TaxId:28901] [189434] (1 PDB entry) |
![]() | Domain d3ocqa_: 3ocq A: [182939] automated match to d1z3aa1 complexed with zn |
PDB Entry: 3ocq (more details), 2.05 Å
SCOPe Domain Sequences for d3ocqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ocqa_ c.97.1.2 (A:) automated matches {Salmonella enterica [TaxId: 28901]} ldheywmrhaltlakrawderevpvgavlvhnhrvigegwnrpigrhdptahaeimalrq gglvlqnyrlldttlyvtlepcvmcagamvhsrigrvvfgardaktgaagslidvlhhpg mnhrveiiegvlrdecatllsdffrm
Timeline for d3ocqa_: