Lineage for d3ocqa_ (3ocq A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918566Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
    strand 5 is parallel to strand 4
  6. 2918657Protein automated matches [191178] (1 species)
    not a true protein
  7. 2918658Species Salmonella enterica [TaxId:28901] [189434] (1 PDB entry)
  8. 2918659Domain d3ocqa_: 3ocq A: [182939]
    automated match to d1z3aa1
    complexed with zn

Details for d3ocqa_

PDB Entry: 3ocq (more details), 2.05 Å

PDB Description: crystal structure of trna-specific adenosine deaminase from salmonella enterica
PDB Compounds: (A:) Putative Cytosine/adenosine deaminase

SCOPe Domain Sequences for d3ocqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ocqa_ c.97.1.2 (A:) automated matches {Salmonella enterica [TaxId: 28901]}
ldheywmrhaltlakrawderevpvgavlvhnhrvigegwnrpigrhdptahaeimalrq
gglvlqnyrlldttlyvtlepcvmcagamvhsrigrvvfgardaktgaagslidvlhhpg
mnhrveiiegvlrdecatllsdffrm

SCOPe Domain Coordinates for d3ocqa_:

Click to download the PDB-style file with coordinates for d3ocqa_.
(The format of our PDB-style files is described here.)

Timeline for d3ocqa_: