SCOPe 2.05: Domain d3occf_: 3occ F:

Lineage for d3occf_ (3occ F:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein automated matches [190142] (18 species)
   not a true protein

7. Species Yersinia pseudotuberculosis [TaxId:502800] [189524] (1 PDB entry)

8. Domain d3occf_: 3occ F: [182934]
   automated match to d1a69a_
   complexed with dih, po4

Details for d3occf_

PDB Entry: 3occ, 1.7 Å

PDB Description: crystal structure of pnp with dadmeimmh from yersinia pseudotuberculosis

PDB Compounds: (F:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d3occf_:

Sequence; same for both SEQRES and ATOM records:

>d3occf_ c.56.2.1 (F:) automated matches {Yersinia pseudotuberculosis [TaxId: 502800]}
atphinaemgdfadvvlmpgdplrakfiaetflqdvrevnnvrgmlgftgtykgrkisvm
ghgmgipscsiyakelitdfgvkkiirvgscgavrtdvklrdvvigmgactdskvnrmrf
kdhdyaaiadfemtrnavdaakakgvnvrvgnlfsadlfytpdpqmfdvmekygilgvem
eaagiygvaaefgakaltictvsdhirtgeqttaaerqttfndmieialesvllgdna

Timeline for d3occf_:

• d3occf_ first appeared in SCOPe 2.01
  
• d3occf_ appears in SCOPe 2.04
  
• d3occf_ appears in SCOPe 2.06
  
• d3occf_ appears in the current release, SCOPe 2.08