Lineage for d3occe_ (3occ E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2888641Protein automated matches [190142] (21 species)
    not a true protein
  7. 2888839Species Yersinia pseudotuberculosis [TaxId:502800] [189524] (1 PDB entry)
  8. 2888844Domain d3occe_: 3occ E: [182933]
    automated match to d1a69a_
    complexed with dih, po4

Details for d3occe_

PDB Entry: 3occ (more details), 1.7 Å

PDB Description: crystal structure of pnp with dadmeimmh from yersinia pseudotuberculosis
PDB Compounds: (E:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d3occe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3occe_ c.56.2.1 (E:) automated matches {Yersinia pseudotuberculosis [TaxId: 502800]}
atphinaemgdfadvvlmpgdplrakfiaetflqdvrevnnvrgmlgftgtykgrkisvm
ghgmgipscsiyakelitdfgvkkiirvgscgavrtdvklrdvvigmgactdskvnrmrf
kdhdyaaiadfemtrnavdaakakgvnvrvgnlfsadlfytpdpqmfdvmekygilgvem
eaagiygvaaefgakaltictvsdhirtgeqttaaerqttfndmieialesvllgdna

SCOPe Domain Coordinates for d3occe_:

Click to download the PDB-style file with coordinates for d3occe_.
(The format of our PDB-style files is described here.)

Timeline for d3occe_: