Lineage for d1e1qa1 (1e1q A:380-510)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4749Fold a.69: Left-handed superhelix [47916] (2 superfamilies)
  4. 4750Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 4751Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)
  6. 4752Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (3 species)
  7. 4756Species Cow (Bos taurus) [TaxId:9913] [47920] (7 PDB entries)
  8. 4775Domain d1e1qa1: 1e1q A:380-510 [18293]
    Other proteins in same PDB: d1e1qa2, d1e1qa3, d1e1qb2, d1e1qb3, d1e1qc2, d1e1qc3, d1e1qd2, d1e1qd3, d1e1qe2, d1e1qe3, d1e1qf2, d1e1qf3, d1e1qg_

Details for d1e1qa1

PDB Entry: 1e1q (more details), 2.61 Å

PDB Description: bovine mitochondrial f1-atpase at 100k

SCOP Domain Sequences for d1e1qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1qa1 a.69.1.1 (A:380-510) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

SCOP Domain Coordinates for d1e1qa1:

Click to download the PDB-style file with coordinates for d1e1qa1.
(The format of our PDB-style files is described here.)

Timeline for d1e1qa1: