Lineage for d3ocbb_ (3ocb B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042269Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1043604Protein automated matches [190091] (8 species)
    not a true protein
  7. 1043667Species Human (Homo sapiens) [TaxId:9606] [188447] (254 PDB entries)
  8. 1043928Domain d3ocbb_: 3ocb B: [182928]
    automated match to d1o6ka_
    complexed with xm1

Details for d3ocbb_

PDB Entry: 3ocb (more details), 2.7 Å

PDB Description: Akt1 kinase domain with pyrrolopyrimidine inhibitor
PDB Compounds: (B:) v-akt murine thymoma viral oncogene homolog 1 (AKT1)

SCOPe Domain Sequences for d3ocbb_:

Sequence, based on SEQRES records: (download)

>d3ocbb_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvtmnefeylkllgkgtfgkvilvkekatgryyamkilkkevivakdevahtltenrvlq
nsrhpfltalkysfqthdrlcfvmeyanggelffhlsrervfsedrarfygaeivsaldy
lhseknvvyrdlklenlmldkdghikitdfglckegikdgatmktfcgtpeylapevled
ndygravdwwglgvvmyemmcgrlpfynqdheklfelilmeeirfprtlgpeaksllsgl
lkkdpkqrlgggsedakeimqhrffagivwqhvyekklsppfkpqvtsetdtryfdeeft
aqmititppdqddsmecvdserrphfpqfdysass

Sequence, based on observed residues (ATOM records): (download)

>d3ocbb_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvtmnefeylkllgkgtfgkvilvkekatgryyamkilkkevivakdevahtltenrvlq
nsrhpfltalkysfqthdrlcfvmeyanggelffhlsrervfsedrarfygaeivsaldy
lhseknvvyrdlklenlmldkdghikitdfglckegikdgatmktfcgtpeylapevled
ndygravdwwglgvvmyemmcgrlpfynqdheklfelilmeeirfprtlgpeaksllsgl
lkkdpkqrlgggsedakeimqhrffagivwqhvyekklsppfkpqvtsetdtryfdeeft
aqmititrphfpqfdysass

SCOPe Domain Coordinates for d3ocbb_:

Click to download the PDB-style file with coordinates for d3ocbb_.
(The format of our PDB-style files is described here.)

Timeline for d3ocbb_: