SCOPe 2.05: Domain d3obua_: 3obu A:

Lineage for d3obua_ (3obu A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.2: UEV domain [75383] (3 proteins)

6. Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75385] (11 PDB entries)

8. Domain d3obua_: 3obu A: [182923]
   automated match to d1kppa_

Details for d3obua_

PDB Entry: 3obu, 1.6 Å

PDB Description: Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 PTAP peptide

PDB Compounds: (A:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d3obua_:

Sequence; same for both SEQRES and ATOM records:

>d3obua_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
savsesqlkkmvskykyrdltvretvnvitlykdlkpvldsygtgsrelmnltgtipvpy
rgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqsd
llgliqvmivvfgdeppvfsrp

Timeline for d3obua_:

• d3obua_ first appeared in SCOPe 2.01
  
• d3obua_ appears in SCOPe 2.04
  
• d3obua_ is called d3obua1 in SCOPe 2.06
  
• d3obua_ appears in the current release, SCOPe 2.08, called d3obua1