Lineage for d3obua1 (3obu A:2-145)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2939400Family d.20.1.2: UEV domain [75383] (3 proteins)
  6. 2939401Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)
  7. 2939402Species Human (Homo sapiens) [TaxId:9606] [75385] (14 PDB entries)
  8. 2939403Domain d3obua1: 3obu A:2-145 [182923]
    Other proteins in same PDB: d3obua2
    automated match to d1kppa_

Details for d3obua1

PDB Entry: 3obu (more details), 1.6 Å

PDB Description: Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 PTAP peptide
PDB Compounds: (A:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d3obua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3obua1 d.20.1.2 (A:2-145) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsygtgsrelmnltgtipvpyr
gntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqsdl
lgliqvmivvfgdeppvfsrp

SCOPe Domain Coordinates for d3obua1:

Click to download the PDB-style file with coordinates for d3obua1.
(The format of our PDB-style files is described here.)

Timeline for d3obua1: