SCOPe 2.06: Domain d3obsa1: 3obs A:2-143

Lineage for d3obsa1 (3obs A:2-143)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.2: UEV domain [75383] (3 proteins)

6. Protein automated matches [191205] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189548] (1 PDB entry)

8. Domain d3obsa1: 3obs A:2-143 [182922]
   Other proteins in same PDB: d3obsa2
   automated match to d1kppa_

Details for d3obsa1

PDB Entry: 3obs, 1.5 Å

PDB Description: Crystal structure of Tsg101 UEV domain

PDB Compounds: (A:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d3obsa1:

Sequence; same for both SEQRES and ATOM records:

>d3obsa1 d.20.1.2 (A:2-143) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsygtgsrelmnltgtipvpyr
gntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqsdl
lgliqvmivvfgdeppvfs

Timeline for d3obsa1:

• d3obsa1 first appeared in SCOPe 2.01, called d3obsa_
  
• d3obsa1 was called d3obsa_ in SCOPe 2.05
  
• d3obsa1 appears in SCOPe 2.07
  
• d3obsa1 appears in the current release, SCOPe 2.08